PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0160400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 184aa    MW: 20577.4 Da    PI: 9.3888
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0160400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.5e-181764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ v+ +G g+W+++++  g+ R++k+c++rw +yl
   Spipo0G0160400 17 KGLWSPEEDEKLLRHVTTYGHGCWSSVPKLAGLQRCGKSCRLRWMNYL 64
                     678*******************************************97 PP

2Myb_DNA-binding48.42.1e-1570112145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg++++eE+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w+
   Spipo0G0160400  70 RGAFSPEEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWN 112
                      89********************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-26967IPR009057Homeodomain-like
PROSITE profilePS5129418.5211264IPR017930Myb domain
SuperFamilySSF466891.31E-3015111IPR009057Homeodomain-like
SMARTSM007172.5E-131666IPR001005SANT/Myb domain
PfamPF002493.8E-161764IPR001005SANT/Myb domain
CDDcd001672.62E-122064No hitNo description
PROSITE profilePS5129425.12665119IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2668119IPR009057Homeodomain-like
SMARTSM007173.1E-1369117IPR001005SANT/Myb domain
PfamPF002492.1E-1470112IPR001005SANT/Myb domain
CDDcd001672.09E-1072112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
RCLMGRHSCC FKQKLRKGLW SPEEDEKLLR HVTTYGHGCW SSVPKLAGLQ RCGKSCRLRW  60
MNYLRPDLKR GAFSPEEENL IIELHAVLGN RWSQIAAQLP GRTDNEIKNL WNSSIKKQLR  120
QRGIDPTTHR PLSEVNAGVD KTAASDELVN PIPSPPSGNS KELFLDQSSS SSCRSPVDYG  180
GGGH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-31151195108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010914802.11e-89PREDICTED: myb-related protein Myb4-like
RefseqXP_011087570.13e-89PREDICTED: transcription factor MYB86-like
SwissprotQ8LPH64e-82MYB86_ARATH; Transcription factor MYB86
TrEMBLQ0PJD41e-89Q0PJD4_SOYBN; MYB transcription factor MYB64 (Fragment)
TrEMBLA0A059PRD82e-89A0A059PRD8_SALMI; MYB-related transcription factor
STRINGBra030783.1-P1e-87(Brassica rapa)
STRINGscaffold_100991.11e-87(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.16e-91myb domain protein 61